PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.101530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 175aa    MW: 20028.2 Da    PI: 8.0001
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.101530.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.15e-3083141159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDg++WrKYG+K+vk+s++pr+YY+C+s +C vkk+ver+++d ++v++tYeg Hnhe
  Cucsa.101530.1  83 LDDGFKWRKYGKKSVKNSPHPRNYYKCSSGECGVKKRVERDRDDSSYVITTYEGVHNHE 141
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.1E-3368143IPR003657WRKY domain
SuperFamilySSF1182901.07E-2776143IPR003657WRKY domain
PROSITE profilePS5081130.02178143IPR003657WRKY domain
SMARTSM007745.6E-3483142IPR003657WRKY domain
PfamPF031066.0E-2484141IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MNSLQNPNFF FDHHQQFDQD HSSSSIMDFL NFSGYPLPDF GLEAETTTDD GWFEGKGVKR  60
KKPRENGRTN RVAFITKSEL EILDDGFKWR KYGKKSVKNS PHPRNYYKCS SGECGVKKRV  120
ERDRDDSSYV ITTYEGVHNH ESPFLMYCNG SKLFHPHPIC PNSSSPPYSS TTTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-2567143177Probable WRKY transcription factor 4
2lex_A7e-2567143177Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818751e-71LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132621e-71LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141964.11e-114PREDICTED: probable WRKY transcription factor 51
TrEMBLA0A0A0KFX21e-114A0A0A0KFX2_CUCSA; Uncharacterized protein
STRINGVIT_07s0031g01710.t014e-42(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.11e-38WRKY DNA-binding protein 50